Discover/Unmc API
live

Unmc APIaps.unmc.edu

Search the APD6 database of antimicrobial peptides, retrieve detailed peptide records, and predict physicochemical properties of amino acid sequences via 3 endpoints.

Endpoints
3
Updated
2mo ago

What is the Unmc API?

This API provides access to the APD6 Antimicrobial Peptide Database through 3 endpoints covering search, detailed record retrieval, and sequence prediction. Use search_peptides to query thousands of catalogued AMPs by name, source organism, activity, or sequence motif. Use get_peptide to pull full records including physicochemical properties and literature references. Use predict_peptide to calculate properties for any novel amino acid sequence.

This call costs10 credits / call— charged only on success
Try it
Peptide name or partial name to search for (e.g. 'LL-37', 'cathelicidin', 'human').
Sort order for results.
Filter by peptide length range.
Comma-separated list of biological activities to filter by. Accepted values: antibacterial, antiviral, antifungal, antiparasitic, anticancer, anti-hiv, anti-mrsa, anti-tb, antibiofilm, wound_healing, anti-inflammatory, chemotaxis, antioxidant, spermicidal, insecticidal, anti-endotoxin, anti-toxin, anti-diabetes, ion_channel, protease_inhibitors, nematocidal, bacteria_agglutinating, synergistic.
Amino acid sequence or motif to search for within peptide sequences (e.g. 'YGNGV', 'GLFD', 'CC').
Filter by 3D structure type.
Filter by net charge.
Source organism to filter by (e.g. 'Homo sapiens', 'Rana').
api.parse.bot/scraper/8dc7511b-87c3-48ad-b97b-1168f444ce45/<endpoint>
Ready to send
Fill in the parameters and hit sign in to send to see live response data here.
Call it over HTTPgrab a free API key at signup
curl -X POST 'https://api.parse.bot/scraper/8dc7511b-87c3-48ad-b97b-1168f444ce45/search_peptides' \
  -H 'X-API-Key: $PARSE_API_KEY' \
  -H 'Content-Type: application/json' \
  -d '{
  "name": "LL-37",
  "sort": "ID",
  "length": "Any",
  "structure": "Any",
  "net_charge": "Any"
}'
All endpoints · 3 totalmissing one? ·

Search the APD6 database for antimicrobial peptides. Supports filtering by name, source organism, sequence content, and biological activity. Returns a list of matching peptides with their APD IDs, descriptions, sequences, and lengths. All filter parameters are optional; omitting all returns all peptides in the database.

Input
ParamTypeDescription
namestringPeptide name or partial name to search for (e.g. 'LL-37', 'cathelicidin', 'human').
sortstringSort order for results.
lengthstringFilter by peptide length range.
activitystringComma-separated list of biological activities to filter by. Accepted values: antibacterial, antiviral, antifungal, antiparasitic, anticancer, anti-hiv, anti-mrsa, anti-tb, antibiofilm, wound_healing, anti-inflammatory, chemotaxis, antioxidant, spermicidal, insecticidal, anti-endotoxin, anti-toxin, anti-diabetes, ion_channel, protease_inhibitors, nematocidal, bacteria_agglutinating, synergistic.
sequencestringAmino acid sequence or motif to search for within peptide sequences (e.g. 'YGNGV', 'GLFD', 'CC').
structurestringFilter by 3D structure type.
net_chargestringFilter by net charge.
source_organismstringSource organism to filter by (e.g. 'Homo sapiens', 'Rana').
Response
{
  "type": "object",
  "fields": {
    "results": "array of peptide summaries with apd_id, numeric_id, pdb_id, description, sequence, length",
    "total_count": "integer"
  },
  "sample": {
    "data": {
      "results": [
        {
          "apd_id": "AP00309",
          "length": 27,
          "pdb_id": "",
          "sequence": "KSKEKIGKEFKRIVQRIKDFLRNLVPR",
          "numeric_id": "00309",
          "description": "Human KS-27 (natural AMPs; UCLL1; fragment of LL-37, cathelicidin, primates, mammals, animals)"
        },
        {
          "apd_id": "AP00310",
          "length": 37,
          "pdb_id": "2K6O",
          "sequence": "[LL-37, 37 aa]",
          "numeric_id": "00310",
          "description": "LL-37 (LL37; cell-penetrating; natural AMPs; cathelicidin; UCLL1; human; primates, mammals, animals; XXE, XXI, XXX; XXY; XXZ; BBBh2o,BBBm;BBMm,BBPP,BBN,BBL,BBrsg,BBacp;JJsn)"
        }
      ],
      "total_count": 52
    },
    "status": "success"
  }
}

About the Unmc API

Searching the AMP Catalog

The search_peptides endpoint accepts up to eight optional filter parameters — name, source_organism, sequence, activity, structure, net_charge, length, and sort — and returns an array of matching peptide summaries. Each result includes the apd_id, numeric_id, pdb_id, description, sequence, and length. Omitting all filters returns the full result set. The activity parameter accepts a comma-separated list of values such as antibacterial, antiviral, or antifungal, making it straightforward to narrow results to a specific therapeutic context.

Retrieving Full Peptide Records

Once you have an APD numeric ID from search results, get_peptide returns the complete record for that peptide. Response fields include title, apd_id, author, length, method, source, activity, sequence, reference, and name_class. The peptide_id input must be a numeric string and may be provided zero-padded to five digits (e.g., 00310) or without leading zeros. The reference field carries literature citations, and method describes how the peptide's structure was determined.

Predicting Properties for Novel Sequences

The predict_peptide endpoint accepts any amino acid sequence in standard one-letter codes and returns a known_amp boolean indicating whether the sequence matches an existing APD entry. For sequences not already catalogued, the response includes calculated physicochemical properties: net_charge, molecular_weight, molecular_formula, gravy (GRAVY hydrophobicity index), boman_index, rich_in (most abundant residue), and length. If the sequence is a known AMP, the response instead returns the matching apd_id for cross-referencing with get_peptide.

Coverage and Data Shape

All three endpoints reflect the APD6 dataset, which covers natural and synthetic antimicrobial peptides across bacteria, viruses, fungi, parasites, and cancer cell targets. The source_organism filter on search_peptides accepts genus-level names such as Rana or full binomials like Homo sapiens. Sequence searches match exact motifs within the stored sequences, useful for identifying peptides containing conserved structural patterns like YGNGV or cysteine-rich motifs.

Reliability & maintenance

The Unmc API is a managed, monitored endpoint for aps.unmc.edu — not a raw scraper you maintain. Every endpoint is automatically health-checked on a schedule, and when aps.unmc.edu changes and a check fails, the API is automatically queued for repair and re-verified. It is built to keep working as the site underneath it changes.

This isn't an official aps.unmc.edu API — it's an independent, maintained REST wrapper over public data. Where the source has no official API (or only a limited one), Parse gives you a stable contract over a source that never promised one, and keeps it current. Need a new endpoint or field? You can revise it yourself in plain English and the agent rebuilds it against the live site in minutes — contributing the change back to the shared API is free.

Will this API break when the source site changes?+
It's built not to. Every endpoint is health-checked on a schedule with automated test probes. When the source site changes and a check fails, the API is automatically queued for repair and re-verified — that's the self-healing layer. Each API page shows when its endpoints were last verified. And because marketplace APIs are shared, any fix reaches everyone using it.
Is this an official API from the source site?+
No — Parse APIs are independent, managed REST wrappers over publicly available data. That is the point: where a site has no official API (or only a limited one), Parse gives you a maintained, monitored endpoint for that data and keeps it working as the site changes — so you get a stable contract over a source that never promised one.
Can I fix or extend this API myself if I need a new endpoint or field?+
Yes — and you don't have to wait on us. This API was generated by the Parse agent, which stays attached. Describe the change in plain English ("add an endpoint that returns reviews", "fix the price field") in the revise box on the API page or via the revise_api MCP tool, and the agent rebuilds it against the live site in minutes. Contributing the change back to the public API is free.
What happens if I call an endpoint that has an issue?+
Errors are machine-readable: a bad call returns a clean status with the list of available endpoints and a repair hint, so an agent (or you) can recover or trigger a fix instead of failing silently. Confirmed failures feed the automatic repair queue.
Common use cases
  • Identify all human-derived antimicrobial peptides by filtering search_peptides with source_organism: 'Homo sapiens'
  • Retrieve the full literature reference and method details for a known AMP using get_peptide with its APD numeric ID
  • Screen a novel peptide candidate by submitting its amino acid sequence to predict_peptide and checking boman_index and net_charge
  • Find all peptides with antiviral activity by passing activity: 'antiviral' to search_peptides
  • Locate peptides containing a specific sequence motif (e.g., GLFD) using the sequence parameter in search_peptides
  • Compare molecular weight and GRAVY score across candidate sequences before committing to synthesis
  • Cross-reference a prediction result with the full APD record when predict_peptide returns known_amp: true and an apd_id
Pricing & limitsSee full pricing →
TierPriceCredits/monthRate limit
Free$0/mo2005 req/min
Hobby$30/mo1,00020 req/min
Developer$100/mo5,000100 req/min
Team$300/mo20,000300 req/min
Company$1,000/mo100,000500 req/min

Each endpoint has a fixed posted price per successful call — most fall between 1 and 10 credits — shown on this API's page before you run it. Exceeding the rate limit returns a 429 response. Authenticate with the X-API-Key header.

Frequently asked questions
Does aps.unmc.edu provide an official public developer API?+
The APD (Antimicrobial Peptide Database) at aps.unmc.edu offers a web interface and some batch tools for researchers, but no documented public REST API is officially published for third-party programmatic access.
What does `predict_peptide` return for a sequence that already exists in the database?+
When known_amp is true, the response returns the matching apd_id and input_sequence but omits the calculated physicochemical fields (net_charge, molecular_weight, molecular_formula, gravy, boman_index). You can then pass the apd_id numeric portion to get_peptide to retrieve the full catalogued record.
Can I filter `search_peptides` results by multiple activities at once?+
Yes. The activity parameter accepts a comma-separated list, so you can pass values like antibacterial,antifungal to retrieve peptides annotated with any of those activities in a single request.
Does the API return peptide 3D structural coordinates or PDB files?+
No. The search_peptides endpoint includes a pdb_id field in results, and get_peptide includes structural metadata via the method field, but actual 3D coordinate data or PDB file content is not returned by any endpoint. You can fork this API on Parse and revise it to add an endpoint that fetches coordinates from the RCSB PDB using the returned pdb_id.
Is there a way to retrieve all peptides in the database without any filters?+
Calling search_peptides with all filter parameters omitted returns results across the full catalog, up to the response limits. The total_count field in the response indicates how many records match. Pagination parameters are not currently exposed as inputs, so very large result sets may be truncated. You can fork this API on Parse and revise it to add offset or page-based pagination support.
Page content last updated . Spec covers 3 endpoints from aps.unmc.edu.
Related APIs in HealthcareSee all →
drugs.com API
Search for drugs and pill identifications, get detailed information about FDA approvals and drug interactions, and find medications by condition or letter. Look up side effects, dosages, and potential drug interactions to make informed health decisions.
pmc.ncbi.nlm.nih.gov API
Search millions of full-text biomedical research articles and access their metadata, citations, and related papers from PubMed Central. Find articles by topic, discover similar research, explore journal collections, and retrieve detailed citation information to support your literature review and research.
clinicaltrials.gov API
Search and retrieve comprehensive information about clinical trials worldwide, including study details, eligibility criteria, locations, and outcomes data. Access structured metadata and statistics to find relevant research studies matching your specific medical conditions or research interests.
ncbi.nlm.nih.gov API
Search and retrieve biomedical literature from NCBI databases including PubMed, PubMed Central, and MeSH. Supports full-text extraction, metadata lookup, and research filtering.
pubmed.ncbi.nlm.nih.gov API
Search and retrieve biomedical literature from PubMed and NCBI databases. Supports keyword search, advanced field-tag queries, clinical filters, citation matching, date filtering, publication type filtering, and direct E-utilities access.
blast.ncbi.nlm.nih.gov API
Compare DNA and protein sequences against NCBI's massive biological databases to find matching sequences and analyze genetic similarities. Submit alignment jobs, monitor their progress, and retrieve detailed results in structured format to support genomics research and sequence analysis.
zocdoc.com API
Search for doctors and medical practices on Zocdoc by specialty and location. Retrieve provider profiles, accepted insurance, office locations, patient reviews, and appointment availability.
mayocliniclabs.com API
Search and browse Mayo Clinic Laboratories' medical test catalog to retrieve detailed information on thousands of available tests, including descriptions, specimen requirements, clinical and interpretive data, performance characteristics, fees and codes, and setup details. Use autocomplete and alphabetical browsing to quickly locate specific tests or explore the full catalog.
APD6 Antimicrobial Peptide Database API · Parse